PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr007879.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family G2-like
Protein Properties Length: 339aa    MW: 36837.2 Da    PI: 7.7117
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr007879.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.11.7e-32193248156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+ eLH+rFv+a++qLGG+++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Pbr007879.1 193 KQRRCWSAELHRRFVDALQQLGGTQVATPKQIRELMQVEGLTNDEVKSHLQKYRLH 248
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.82E-18191251IPR009057Homeodomain-like
PROSITE profilePS5129411.819192250IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-29192251IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26193248IPR006447Myb domain, plants
PfamPF002494.9E-8195246IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MLLLKDVIER LKEEGMRWRR IEERPVMAEF IPLKGNSVED GGAVSGKENI DKKNWMSSAQ  60
LWSTSMNVFD YTKHDSELKL GNEEDDRSAA ENPIELSNKK GVGGALLAFK GQNELSGFAN  120
PCLKGDKEVT VVPNLCLMTP LMSETLAGSA NANSKTNHGC RGGGSGSGMA GQLKLQNKPQ  180
QQPQQQQEQP LRKQRRCWSA ELHRRFVDAL QQLGGTQVAT PKQIRELMQV EGLTNDEVKS  240
HLQKYRLHIR KLPPSSAAGQ GNDLLVPLDH SGEHAKANNV QSGSPLGPLL TGGFAKGRST  300
TGGKSGDSRE GEEDEKSDGQ SWTSGNHNHH HHQGAGDV*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009366793.10.0PREDICTED: uncharacterized protein LOC103956513 isoform X1
TrEMBLM5WFN31e-158M5WFN3_PRUPE; Uncharacterized protein
STRINGVIT_07s0197g00060.t013e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-34G2-like family protein